473,372 Members | 980 Online
Bytes | Software Development & Data Engineering Community
Post Job

Home Posts Topics Members FAQ

Join Bytes to post your question to a community of 473,372 software developers and data experts.

expat parser

I have this code:

import xml.parsers.expat
def start_element(name, attrs):
print 'Start element:', name, attrs
def end_element(name):
print 'End element:', name
def char_data(data):
print 'Character data:', repr(data)
p = xml.parsers.expat.ParserCreate()
p.StartElementHandler = start_element
p.EndElementHandler = end_element
p.CharacterDataHandler = char_data
fh=open("/home/sbassi/bioinfo/smallUniprot.xml","r")
p.ParseFile(fh)

And I get this on the output:

....
Start element: sequence {u'checksum': u'E0C0CC2E1F189B8A', u'length': u'393'}
Character data: u'\n'
Character data: u'MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRK RL'
Character data: u'\n'
Character data: u'EAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKL IH'
....
End element: sequence
....

Is there a way to have the character data together in one string? I
guess it should not be difficult, but I can't do it. Each time the
parse reads a line, return a line, and I want to have it in one
variable.

(the file is here: http://sbassi.googlepages.com/smallUniprot.xml)
May 27 '07 #1
1 1556
Sebastian Bassi wrote:
I have this code:

import xml.parsers.expat
def start_element(name, attrs):
print 'Start element:', name, attrs
def end_element(name):
print 'End element:', name
def char_data(data):
print 'Character data:', repr(data)
p = xml.parsers.expat.ParserCreate()
p.StartElementHandler = start_element
p.EndElementHandler = end_element
p.CharacterDataHandler = char_data
fh=open("/home/sbassi/bioinfo/smallUniprot.xml","r")
p.ParseFile(fh)

And I get this on the output:

...
Start element: sequence {u'checksum': u'E0C0CC2E1F189B8A', u'length':
u'393'}
Character data: u'\n'
Character data: u'MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRK RL'
Character data: u'\n'
Character data: u'EAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKL IH'
...
End element: sequence
...

Is there a way to have the character data together in one string? I
guess it should not be difficult, but I can't do it. Each time the
parse reads a line, return a line, and I want to have it in one
variable.
Any reason you are using expat and not cElementTree's iterparse?

Stefan
May 28 '07 #2

This thread has been closed and replies have been disabled. Please start a new discussion.

Similar topics

1
by: Will Stuyvesant | last post by:
There seems to be no XML parser that can do validation in the Python Standard Libraries. And I am stuck with Python 2.1.1. until my web master upgrades (I use Python for CGI). I know pyXML has...
1
by: Doug | last post by:
I am running solaris 7 on two machines. I compiled python 2.2.1 with expat parser on one machine. The python binary is located in /usr/local/bin and the libraries are located in /usr/local/lib. ...
0
by: Fabian Kr?ger | last post by:
Hello, I got a weird problem and need your help and ideas... I´ve written an php application which imports data in XML format and writes this data to a MySQL database to have a faster access....
4
by: Jakob Møbjerg Nielsen | last post by:
Expat keeps telling me that there is "junk after document element". I've tried different encoding, and I'm quite sure that the buffer is nul-terminated. I really have no idea to what the problem...
4
by: Sridhar | last post by:
HI All, Currently writing a small program and here is my xml file and program. --------------------------------------------------------------------------------- <?xml version="1.0"...
2
by: Steve Juranich | last post by:
I'm running into problems where Python and VTK both ship with their own distribution of the Expat parser. As long as you never use the Python XML package, everything is fine. But if you try using...
4
by: Maarten Verhage | last post by:
Hi All, I've made a modified version of the Expat elements.c example. What I want the program to do is to recognize a hardcoded element-name/tag-name and then execute some code which has access...
1
by: vadlapatlahari | last post by:
Hi, I get the following error with Expat while configuring my application server. Can anyone suggest a solution? When i do an ldd, i get the following : $ldd Expat.so Expat.so needs:...
0
by: kjs1028x | last post by:
Hi! I am using Expat to parse XML files. I have implemented start/end/data handlers for my parser. My parser is able to parse XML files, but it does not return after it has completed parsing. When...
1
by: porchemasi | last post by:
Im trying to parse the following <channel> <newsItem> <newsTitle>U.S. Tops Guatemala 2-0 in Cup Qualifier (AP)</newsTitle> <reporters> <reporter>RONALD BLUM</reporter> </reporters> ...
0
isladogs
by: isladogs | last post by:
The next Access Europe User Group meeting will be on Wednesday 3 Apr 2024 starting at 18:00 UK time (6PM UTC+1) and finishing by 19:30 (7.30PM). In this session, we are pleased to welcome former...
0
by: ryjfgjl | last post by:
In our work, we often need to import Excel data into databases (such as MySQL, SQL Server, Oracle) for data analysis and processing. Usually, we use database tools like Navicat or the Excel import...
0
by: Charles Arthur | last post by:
How do i turn on java script on a villaon, callus and itel keypad mobile phone
0
by: aa123db | last post by:
Variable and constants Use var or let for variables and const fror constants. Var foo ='bar'; Let foo ='bar';const baz ='bar'; Functions function $name$ ($parameters$) { } ...
0
by: ryjfgjl | last post by:
If we have dozens or hundreds of excel to import into the database, if we use the excel import function provided by database editors such as navicat, it will be extremely tedious and time-consuming...
0
by: ryjfgjl | last post by:
In our work, we often receive Excel tables with data in the same format. If we want to analyze these data, it can be difficult to analyze them because the data is spread across multiple Excel files...
0
by: emmanuelkatto | last post by:
Hi All, I am Emmanuel katto from Uganda. I want to ask what challenges you've faced while migrating a website to cloud. Please let me know. Thanks! Emmanuel
0
BarryA
by: BarryA | last post by:
What are the essential steps and strategies outlined in the Data Structures and Algorithms (DSA) roadmap for aspiring data scientists? How can individuals effectively utilize this roadmap to progress...
1
by: nemocccc | last post by:
hello, everyone, I want to develop a software for my android phone for daily needs, any suggestions?

By using Bytes.com and it's services, you agree to our Privacy Policy and Terms of Use.

To disable or enable advertisements and analytics tracking please visit the manage ads & tracking page.