mysql query split into array

[kumarboston]

Hi All,
I fetched a sequence from my database into mysql_query and then I want to split in the group of 60 and print it. I am using while loop and pushing into array and then trying to split it and print it on the web page but its nor working????

here is the code:

$res_fasta = mysql_query($fasta) or die('Query failed: ' . mysql_error());
 
while($seq = mysql_fetch_array($res_fasta))
{
    array_push($arr,"{$seq['sp_fasta']}");
}
 

For example: if the sequence is of 500 charecters and then i am trying to print it 60 charecters per line till the end of the sequence.
but when i echo the count in array ite gives me 1 as the value???

confused, any help....

thanks
kumar

[Atli]

Hi kumar,

Have you considered using the substr() function? Or maybe the wordwrap() function?

P.S Please use [code] tags when posting code!

[kumarboston]

Thanks Atli for your help..

the wordwrap is working and i think I will also try with substr...

thanks once again for the help....

kumar

[Atli]

Glad I could help :)
Please don't hesitate to post again if you have any more questions or problems we can help you with!

[kumarboston]

Thanks,
I am able to generate the string of 60 characters in each new line but the edges are not smooth, i tried to use HTML "align = justify" attribute but no success.
here is the output:
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLS LQRMFNNCEV

VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGN MYYENSYALA

VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSS DFLSNMSMDF


each line has 60 characters but the edges are not smooth....any help in this case....


thanks
kumar

[Atli]

This can be fixed by using the right font. Like Courier New, for example.